- TMEM245 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90633
- Human
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: AELPGQVISM AASTLANLAI SITGYESSSE DQPSTQPAEA VDRGESAPTL STSPSPSSPS PTSPSPTLGR RRPEIGTFLR KKK
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- TMEM245
- C9orf5, CG-2, CG2
- Unconjugated
- Rabbit
- transmembrane protein 245
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AELPGQVISMAASTLANLAISITGYESSSEDQPSTQPAEAVDRGESAPTLSTSPSPSSPSPTSPSPTLGRRRPEIGTFLRKKK
Specifications/Features
Available conjugates: Unconjugated